
Goat Anti-Archeoprepona ARD1 Polyclonal Antibody | AB0276

(No reviews yet) Write a Review
3 to 5 Days Shipment
200 µg
2 mg/ml

Display your currency $/£/€ from the header !!!

Frequently bought together:


Goat Anti-Archeoprepona ARD1 IgG Polyclonal Antibody | AB0276 | SICGEN Antibodies

Overview: Goat polyclonal antibody to Chain A defensin ARD1. This peptide isolated from one-spotted leafwing butterfly and moth has been shown to have antimicrobial properties.

Other Names: Heliomycin, ETD135, ETD151 antibody.

Other Names: Heliomycin, ETD135, ETD151 antibody.

Concentration: 2 mg/ml

Antibody Type: Primary

Target Type: Anti-ARD1

Accession Number: N/A

Host Species: Goat

Immunogen Species: Archeoprepona

Immunogen Type: Recombinant protein

Immunogen: Purified recombinant defensin ARD1 (MDKLIGSCVWGAVNYTSNCRAECKRRGYKGGHCGSFANVNCWCET) produced in E. coli

Isotype: IgG

Clonality: Polyclonal

Confirmed Reactive Species: Archeoprepona genus

Specificity Detail: Using the recombinant ARD1 gives a positive signal by Western blot. Due to high homology it is likely to recognise heliomycin

Buffer: PBS, 20% glycerol and 0.05% sodium azide

Purification: Epitope affinity purified

Conjugation: Unconjugated

Format: N/A

Application: WB

Concentration/Dilution: WB:1:500-1:2,000

Storage: N/A

References: N/A

View AllClose

0 Reviews

View AllClose