Description
Goat Anti-Archeoprepona ARD1 IgG Polyclonal Antibody | AB0276 | SICGEN Antibodies
Overview: Goat polyclonal antibody to Chain A defensin ARD1. This peptide isolated from one-spotted leafwing butterfly and moth has been shown to have antimicrobial properties.
Other Names: Heliomycin, ETD135, ETD151 antibody.
Other Names: Heliomycin, ETD135, ETD151 antibody.
Concentration: 2 mg/ml
Antibody Type: Primary
Target Type: Anti-ARD1
Accession Number: N/A
Host Species: Goat
Immunogen Species: Archeoprepona
Immunogen Type: Recombinant protein
Immunogen: Purified recombinant defensin ARD1 (MDKLIGSCVWGAVNYTSNCRAECKRRGYKGGHCGSFANVNCWCET) produced in E. coli
Isotype: IgG
Clonality: Polyclonal
Confirmed Reactive Species: Archeoprepona genus
Specificity Detail: Using the recombinant ARD1 gives a positive signal by Western blot. Due to high homology it is likely to recognise heliomycin
Buffer: PBS, 20% glycerol and 0.05% sodium azide
Purification: Epitope affinity purified
Conjugation: Unconjugated
Format: N/A
Application: WB
Concentration/Dilution: WB:1:500-1:2,000
Storage: N/A
References: N/A