Description
MUCOLIPIN 1 ANTIBODY | 70R-5139 from Fitzgerald
Rabbit polyclonal Mucolipin 1 antibody raised against the N terminal of MCOLN1
MUCOLIPIN 1 ANTIBODY | 70R-5139 DataSheet
Synonyms: Polyclonal Mucolipin 1 antibody, Anti-Mucolipin 1 antibody, Mucolipin 1, Mucolipin -1 antibody, Mucolipin 1, Mucolipin 1 antibody, Mucolipin -1, MCOLN1 antibody
Specificity: Mucolipin 1 antibody was raised against the N terminal of MCOLN1
Cross Reactivity: Human, Dog
Applications: WB
Immunogen: Mucolipin 1 antibody was raised using the N terminal of MCOLN1 corresponding to a region with amino acids FRHLFLLGYSDGADDTFAAYTREQLYQAIFHAVDQYLALPDVSLGRYAYV
Assay Information: Mucolipin 1 Blocking Peptide, catalog no. 33R-3049, is also available for use as a blocking control in assays to test for specificity of this Mucolipin 1 antibody
SPECIFICATIONS
Host: Rabbit
Method of Purification: Affinity purified
Molecular Weight: 64 kDa (MW of target protein)
Form & Buffer: Supplied as liquid, in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration: 1 mg/ml
USAGE & ASSAY INFORMATION
Storage: Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
GENERAL INFORMATION
Biological Significance: MCOLN1 encodes a protein that may be involved in calcium signaling and membrane trafficking in mucolipidosis IV.