Description 0 Reviews Description SLC7A10 Antibody Expression system: Yeast Purity: > 90% SDS-PAGE Suitable for: SDS-PAGE Product name Recombinant Mouse SLC7A10 protein (Tagged) Purity > 90 % SDS-PAGE. Expression system Yeast Accession P63115 Protein length Protein fragment Animal free No Nature Recombinant Species Mouse Sequence WRSKPKCVHRFTESMTRWGQELCFVVYPQGSLEEEENGPMGQPSPLPITD KPLKTQ Amino acids 475 to 530 Additional sequence information N-terminal 6xHis-sumostar-tagged View AllClose 0 Reviews View AllClose
Add to Cart Quick view P2X2 Antibody | Gentaur MSRP: Now: Select Currency //340.00 Was: P2X2 89-GP14106-GEN
Add to Cart Quick view Adenosine Antibody | Gentaur MSRP: Now: Select Currency //340.00 Was: Adeno 26-6652-100-GEN
Add to Cart Quick view MUC5AC Antibody | Gentaur MSRP: Now: Select Currency //340.00 Was: MUC5A 247-OAAD00156-GEN
Add to Cart Quick view Shank3 Antibody | Gentaur MSRP: Now: Select Currency //340.00 Was: Shank 355-25486-GEN
Add to Cart Quick view Histamine Antibody | Gentaur MSRP: Now: Select Currency //340.00 Was: Hista 484-22939-GEN