Description 0 Reviews Description SLC7A10 Antibody Expression system: Yeast Purity: > 90% SDS-PAGE Suitable for: SDS-PAGE Product name Recombinant Mouse SLC7A10 protein (Tagged) Purity > 90 % SDS-PAGE. Expression system Yeast Accession P63115 Protein length Protein fragment Animal free No Nature Recombinant Species Mouse Sequence WRSKPKCVHRFTESMTRWGQELCFVVYPQGSLEEEENGPMGQPSPLPITD KPLKTQ Amino acids 475 to 530 Additional sequence information N-terminal 6xHis-sumostar-tagged View AllClose 0 Reviews View AllClose
Add to Cart Quick view Xylose Antibody | Gentaur MSRP: Now: Select Currency //340.00 Was: Xylos 451-AS07 267-GEN
Add to Cart Quick view PDE4A Antibody | Gentaur MSRP: Now: Select Currency //340.00 Was: PDE4A 292-PD4A-112AP-GEN
Add to Cart Quick view Cholesterol Antibody | Gentaur MSRP: Now: Select Currency //340.00 Was: Chole 639-abx100311-GEN
Add to Cart Quick view SLC35B4 Antibody | Gentaur MSRP: Now: Select Currency //340.00 Was: SLC35 639-abx038287-GEN
Add to Cart Quick view ETV2 Antibody | Gentaur MSRP: Now: Select Currency //340.00 Was: ETV2 544-MBS7112932-GEN