Description 0 Reviews Description SLC7A10 Antibody Expression system: Yeast Purity: > 90% SDS-PAGE Suitable for: SDS-PAGE Product name Recombinant Mouse SLC7A10 protein (Tagged) Purity > 90 % SDS-PAGE. Expression system Yeast Accession P63115 Protein length Protein fragment Animal free No Nature Recombinant Species Mouse Sequence WRSKPKCVHRFTESMTRWGQELCFVVYPQGSLEEEENGPMGQPSPLPITD KPLKTQ Amino acids 475 to 530 Additional sequence information N-terminal 6xHis-sumostar-tagged View AllClose 0 Reviews View AllClose
Add to Cart Quick view KEAP1 Antibody | Gentaur MSRP: Now: Select Currency //340.00 Was: KEAP1 355-32450-100-GEN
Add to Cart Quick view CD81 Antibody | Gentaur MSRP: Now: Select Currency //340.00 Was: CD81 639-abx146510-GEN
Add to Cart Quick view NOV Antibody | Gentaur MSRP: Now: Select Currency //340.00 Was: NOV A 763-E-AB-15124-GEN
Add to Cart Quick view FIS Antibody | Gentaur MSRP: Now: Select Currency //340.00 Was: FIS A 399-CSB-PA483470XA-GEN
Add to Cart Quick view ELOV3 Antibody | Gentaur MSRP: Now: Select Currency //340.00 Was: ELOV3 13-ORB183372-20UG-GEN