Description 0 Reviews Description SLC7A10 Antibody Expression system: Yeast Purity: > 90% SDS-PAGE Suitable for: SDS-PAGE Product name Recombinant Mouse SLC7A10 protein (Tagged) Purity > 90 % SDS-PAGE. Expression system Yeast Accession P63115 Protein length Protein fragment Animal free No Nature Recombinant Species Mouse Sequence WRSKPKCVHRFTESMTRWGQELCFVVYPQGSLEEEENGPMGQPSPLPITD KPLKTQ Amino acids 475 to 530 Additional sequence information N-terminal 6xHis-sumostar-tagged View AllClose 0 Reviews View AllClose
Add to Cart Quick view Thioredoxin Antibody | Gentaur MSRP: Now: zł2,080.80 Was: Thior 04-10384-R214-100-GEN
Add to Cart Quick view SLCO1C1 Antibody | Gentaur MSRP: Now: zł2,080.80 Was: SLCO1 399-CSB-PA868355LA-GEN