Description 0 Reviews Description SLC7A10 Antibody Expression system: Yeast Purity: > 90% SDS-PAGE Suitable for: SDS-PAGE Product name Recombinant Mouse SLC7A10 protein (Tagged) Purity > 90 % SDS-PAGE. Expression system Yeast Accession P63115 Protein length Protein fragment Animal free No Nature Recombinant Species Mouse Sequence WRSKPKCVHRFTESMTRWGQELCFVVYPQGSLEEEENGPMGQPSPLPITD KPLKTQ Amino acids 475 to 530 Additional sequence information N-terminal 6xHis-sumostar-tagged View AllClose 0 Reviews View AllClose
Add to Cart Quick view P2Y12 Antibody FITC | Gentaur MSRP: Now: zł2,080.80 Was: P2Y12 292-P2Y12R-FITC-GEN
Add to Cart Quick view Testosterone Polyclonal Antibody | Gentaur MSRP: Now: zł2,080.80 Was: Testo 617-CAU27861-GEN
Add to Cart Quick view ACOX1 Polyclonal Antibody | Gentaur MSRP: Now: zł2,080.80 Was: ACOX1 498-BS-5021R-GEN
Add to Cart Quick view TFEB, Polyclonal Antibody | Gentaur MSRP: Now: zł2,080.80 Was: TFEB, 544-MBS7049264-GEN
Add to Cart Quick view SATB1 Antibody (EPR3951) | Gentaur MSRP: Now: zł2,080.80 Was: SATB1 520-GTX62474-GEN