Human HLA-E protein | orb246489

(No reviews yet) Write a Review
SKU:
orb246489
Availability:
In Stock
€674.70

 Select your currency from the header

Description

Human HLA-E protein | orb246489

Conjugation Unconjugated
Target HLA-E
Alternative Names
Form/Appearance Liquid or Lyophilized powder
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Tag N-terminal 6xHis-SUMO-tagged
Note For research use only.
Protein Sequence GSHSLKYFHTSVSRPGRGEPRFISVGYVDDTQFVRFDNDAASPRMVPRAPWMEQEGSEYWDRETRSARDTAQIFRVNLRTLRGYYNQSEAGSHTLQWMHGCELGPDRRFLRGYEQFAYDGKDYLTLNEDLRSWTAVDTAAQISEQKSNDASEAEHQRAYLEDTCVEWLHKYLEKGKETLLHLEPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQQDGEGHTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPVTLRWKPASQPTIPI
Purity Greater than 90% as determined by SDS-PAGE.
MW 48.7 kDa
Source E.coli
Expression Region 22-305aa
Uniprot ID P13747
Application Notes Full length of Alpha-1 and Alpha-2 and Alpha-3 of His-SUMO-tag and expression region is 22-305aa
Description Recombinant human HLA class I histocompatibility antigen, alpha chain E

 

View AllClose

0 Reviews

View AllClose