Human HLA-E protein | orb246489
- SKU:
- orb246489
- Availability:
- In Stock
Description
Human HLA-E protein | orb246489
| Conjugation | Unconjugated |
|---|---|
| Target | HLA-E |
| Alternative Names | (click to expand) |
| Form/Appearance | Liquid or Lyophilized powder |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Tag | N-terminal 6xHis-SUMO-tagged |
| Note | For research use only. |
| Protein Sequence | GSHSLKYFHTSVSRPGRGEPRFISVGYVDDTQFVRFDNDAASPRMVPRAPWMEQEGSEYWDRETRSARDTAQIFRVNLRTLRGYYNQSEAGSHTLQWMHGCELGPDRRFLRGYEQFAYDGKDYLTLNEDLRSWTAVDTAAQISEQKSNDASEAEHQRAYLEDTCVEWLHKYLEKGKETLLHLEPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQQDGEGHTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPVTLRWKPASQPTIPI |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| MW | 48.7 kDa |
| Source | E.coli |
| Expression Region | 22-305aa |
| Uniprot ID | P13747 |
| Application Notes | Full length of Alpha-1 and Alpha-2 and Alpha-3 of His-SUMO-tag and expression region is 22-305aa |
| Description | Recombinant human HLA class I histocompatibility antigen, alpha chain E |
Related Products
Human Noggin protein | PRP100077
Select Currency //730.00 - Select Currency //1,759.00
Human Noggin protein | PRP100077 from Abbkine.Product Overwiew:Recombinant Human Noggin Protein (Noggin) expressed in Human Cells.Background:Noggin is a secreted protein involved at multiple stages...
794-PRP100077
Human aFGF protein | PRP100008
Select Currency //179.00 - Select Currency //3,253.00
Human aFGF protein | PRP100008 from Abbkine.Product Overwiew:Recombinant Human aFGF Protein (Fibroblast growth factor 1) expressed in E. coli.Background:aFGF, also known as FGF1 and HBGF-1, is a...
794-PRP100008
Human VEGF165 protein | PRP100239
Select Currency //179.00 - Select Currency //11,373.00
Human VEGF165 protein | PRP100239 from Abbkine.Product Overwiew:Recombinant Human VEGF165 Protein (Vascular endothelial growth factor A) expressed in Baculovirus-Insect Cells.Background:Vascular...
794-PRP100239
Human bFGF protein | PRP1010
Select Currency //135.00 - Select Currency //1,687.00
Human bFGF protein | PRP1010 from Abbkine.Product Overwiew:Recombinant Human bFGF Protein (Fibroblast growth factor 2) expressed in E. coli.Background:Basic fibroblast growth factor (bFGF), also...
794-PRP1010
Human FGF19 protein | PRP100298
Select Currency //454.00 - Select Currency //802.00
Human FGF19 protein | PRP100298 from Abbkine.Product Overwiew:Recombinant Human FGF19 Protein (Fibroblast growth factor 19) expressed in E. coli.Background:FGF19, also known as FGF-19, is a member of...
794-PRP100298