Recombinant Human RBM3

(No reviews yet) Write a Review
SKU:
619-12110002/12110003
Availability:
IN STOCK
$501.62 - $4,684.60

 Select your currency from the header

Description

Recombinant Human RBM3 | 12 110 002\12 110 003 | BioTeZ

Product Features:

Product Group: Protein

Minimum Shelf life Time in months: 6 months

Package size (cm) in Europe/ ouside Europe: 26 x 17 x 19 \33 x 25 x 23

Application: The recombinant RBM3 can serve as standard in immunochemical assays, in Western Blot or other methods.

Concentration: 0.2 µg/µl

Buffe: The RBM3 protein is solubilized in 50 mM Tris-HCl, pH 7.5, 150 mM NaCl, 5 mM CaCl2.

Molecular Weight: 17.2 kDa

Host: N/A

Clonality: N/A

Conjugate: untagged

Immunogen Info: N/A

Product description: The RBM3 (Putative RNA-binding protein 3) is a full length, recombinant protein. The RBM3 protein consists of 157 amino acids and a C-terminal His6-tag.

Reactivity: N/A

Cross Reactivity: N/A

No Cross Reactivity: N/A

Sequence: MSSEEGKLFVGGLNFNTDEQALEDHFSSFGPISEVVVVKDRETQRSRGFGFITFTNPEHASVAMRAMNGESLDGRQIRVDHAGKSARGTRGGGFGAHGRGRSYSRGGGDQGYGSGRYYDSRPGGYGYGYGRSRDYNGRNQGGYDRYSGGNYRDNYDNHHHHHH

Addtional Names: Recombinant Human Putative RNA-binding protein motif 3

Specificity: N/A

Format: liquid

Purity: > 90%

Purification: N/A

Storage: Store at -70°C

Shipping Temp Min: dry ice

Isotype: N/A

Clone: N/A

Source: Recombinant, E.coli

Gene ID: N/A

Uniprot/NCBI/GeneID: P98179

NCBI Official Symbol: RBM3

NCBI Official Full Name: Human Putative RNA-binding protein motif 3

NCBI Organism: Homo sapiens

View AllClose

0 Reviews

View AllClose