Recombinant TMPRSS2 (Transmembrane Protease Serine Subtype 2), His-tagged
- SKU:
- 619-30600102/30600103
- Availability:
- IN STOCK
Description
Recombinant TMPRSS2 (Transmembrane Protease Serine Subtype 2), His-tagged | 30 600 102\30 600 103 | BioTeZ
Product Features:
Product Group: Antibody
Minimum Shelf life Time in months: 6 months
Package size (cm) in Europe/ ouside Europe: 31 x 17 x 19 \26 x 17 x 19
Application: The recombinant TMPRSS2 can serve as standard in immunochemical assays, in Western Blot or other methods.
Concentration: 0.5 mg/ml
Buffe: The TMPRSS2 protein is solubilized in 20 mM Tris-HCl, pH 6.8, 150 mM NaCl,250 mM Arginin, 10% Glycerin
Molecular Weight: 43.8 kDa
Host: N/A
Clonality: N/A
Conjugate: His-tagged
Immunogen Info: N/A
Product description: Recombinant TMPRSS2 is a type II transmembrane serine protease that can cleave and activate the spike protein (S) of the severe acute respiratory syndrome coronavirus (SARS-CoV) for membrane fusion. It is a recombinant protein, expressed in E.coli cells. The protein consists of 386 aa (106-492) amino acids and a C-terminal His6-tag.
Reactivity: N/A
Cross Reactivity: N/A
No Cross Reactivity: N/A
Sequence: KFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGEDENRCVRLYGPNFILQMYSSQRKSWHPVCQDDWNENYGRAACRDMGYKN NFYSSQGIVDDSGSTSFMKLNTSAGNVDIYKKLYHSDACSSKAVVSLRCLACGVNLNSSRQSRIVGGESALPGAWPWQVSLHVQNVHVC GGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFYGAGYQVQKVISHPNYDSKTKNNDIALMKLQKPLTFNDLVKPVCLPNPG MMLQPEQLCWISGWGATEEKGKTSEVLNAAKVLLIETQRCNSRYVYDNLITPAMICAGFLQGNVDSCQGDSGGPLVTSNNNIWWLIGD TSWGSGCAKAYRPGVYGNVMVFTDWIYRQMRADGHHHHHH
Addtional Names: Transmembrane Protease Serine Subtype 2
Specificity: N/A
Format: liquid
Purity: > 90%
Purification: N/A
Storage: Store at -70°C
Shipping Temp Min: dry ice
Isotype: N/A
Clone: N/A
Source: Recombinant, E.coli
Gene ID: N/A
Uniprot/NCBI/GeneID: NP 001128571
NCBI Official Symbol: TMPRSS2
NCBI Official Full Name: Transmembrane Protease Serine Subtype 2
NCBI Organism: Streptomyces avidinii