Recombinant TMPRSS2 (Transmembrane Protease Serine Subtype 2), His-tagged

Recombinant TMPRSS2 (Transmembrane Protease Serine Subtype 2), His-tagged | 30 600 102\30 600 103 | BioTeZ

Product Features:

Product Group: Antibody

Minimum Shelf life Time in months: 6 months

Package size (cm) in Europe/ ouside Europe: 31 x 17 x 19 \26 x 17 x 19

Application: The recombinant TMPRSS2 can serve as standard in immunochemical assays, in Western Blot or other methods.

Concentration: 0.5 mg/ml

Buffe: The TMPRSS2 protein is solubilized in 20 mM Tris-HCl, pH 6.8, 150 mM NaCl,250 mM Arginin, 10% Glycerin

Molecular Weight: 43.8 kDa

Host: N/A

Clonality: N/A

Conjugate: His-tagged

Immunogen Info: N/A

Product description: Recombinant TMPRSS2 is a type II transmembrane serine protease that can cleave and activate the spike protein (S) of the severe acute respiratory syndrome coronavirus (SARS-CoV) for membrane fusion. It is a recombinant protein, expressed in E.coli cells. The protein consists of 386 aa (106-492) amino acids and a C-terminal His6-tag.

Reactivity: N/A

Cross Reactivity: N/A

No Cross Reactivity: N/A

Sequence: KFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGEDENRCVRLYGPNFILQMYSSQRKSWHPVCQDDWNENYGRAACRDMGYKN NFYSSQGIVDDSGSTSFMKLNTSAGNVDIYKKLYHSDACSSKAVVSLRCLACGVNLNSSRQSRIVGGESALPGAWPWQVSLHVQNVHVC GGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFYGAGYQVQKVISHPNYDSKTKNNDIALMKLQKPLTFNDLVKPVCLPNPG MMLQPEQLCWISGWGATEEKGKTSEVLNAAKVLLIETQRCNSRYVYDNLITPAMICAGFLQGNVDSCQGDSGGPLVTSNNNIWWLIGD TSWGSGCAKAYRPGVYGNVMVFTDWIYRQMRADGHHHHHH

Addtional Names: Transmembrane Protease Serine Subtype 2

Specificity: N/A

Format: liquid

Purity: > 90%

Purification: N/A

Storage: Store at -70°C

Shipping Temp Min: dry ice

Isotype: N/A

Clone: N/A

Source: Recombinant, E.coli

Gene ID: N/A

Uniprot/NCBI/GeneID: NP 001128571

NCBI Official Symbol: TMPRSS2

NCBI Official Full Name: Transmembrane Protease Serine Subtype 2

NCBI Organism: Streptomyces avidinii