Boster Bio Anti-Aquaporin 2/AQP2 Antibody Picoband™ catalog # PB9474. Tested in Flow Cytometry, IHC, WB applications. This antibody reacts with Human, Mouse, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-Aquaporin 2/AQP2 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9474)

Host

Rabbit

Contents

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Immunogen

A synthetic peptide corresponding to a sequence at the C-terminus of human Aquaporin 2 (241-271aa EPDTDWEEREVRRRQSVELHSPQSLPRGTKA), different from the related mouse and rat sequences by one amino acid.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross Reactivity

No cross reactivity with other proteins

Reactive Species

PB9474 is reactive to AQP2 in Human, Mouse, Rat