Recombinant Human s-COMT V158M, His-tagged

Recombinant Human s-COMT V158M, His-tagged | 12 210 002\12 210 003 | BioTeZ

Product Features:

Product Group: Protein

Minimum Shelf life Time in months: 6 months

Package size (cm) in Europe/ ouside Europe: 26 x 17 x 19 \33 x 25 x 23

Application: Recombinant s-COMT V158M is used to study the elimination of biologically active or toxic catechols and some other hydroxylated metabolites. It acts as detoxicating barrier between blood and other tissues. COMT activity may regulated the amounts of dopamine and norepinephrine in various parts of the brain and therefore be associated with mood and other metal processes. The enzyme can also serve as standard in enzymatic and immunochemical assays.

Concentration: 0.5 µg/µl

Buffe: s-COMT V158M is solubilized in 50 mM Tris-HCl, pH 7.5, 150 mM NaCl.

Molecular Weight: 25.5 kDa

Host: N/A

Clonality: N/A

Conjugate: His-tagged

Immunogen Info: N/A

Product description: Recombinant human s-COMT/Natural Variant 108/158 Val->Met (51-271) is produced in E. coli. The protein consists of amino acids M51-P271 of MB-COMT (membrane bound) and a C-terminal His6-tag

Reactivity: N/A

Cross Reactivity: N/A

No Cross Reactivity: N/A

Sequence: MGDTKEQRILNHVLQHAEPGNAQSVLEAIDTYCEQKEWAMNVGDKKGKIVDAVIQEHQPSVLLELGAYCGYSAVRMARLLSPGARLITIEINPDCAAITQRMVDFAGMKDKVTLVVGASQDIIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVICPGAPDFLAHVRGSSCFECTHYQSFLEYREVVDGLEKAIYKGPGSEAGPHHHHHH

Addtional Names: soluble Catechol-O-Methyltransferase

Specificity: N/A

Format: liquid

Purity: > 95%

Purification: N/A

Storage: Store at -70°C

Shipping Temp Min: dry ice

Isotype: N/A

Clone: N/A

Source: Recombinant, E.coli

Gene ID: N/A

Uniprot/NCBI/GeneID: P21964-2

NCBI Official Symbol: N/A

NCBI Official Full Name: Catechol-O-Methyltransferase

NCBI Organism: Homo sapiens