Recombinant SARS-CoV-2 Nucleocapsid Protein full length, His-tagged (PODTC9) NC_045512.2; free of nucleic acid
- SKU:
- 619-13100102/13100103
- Availability:
- IN STOCK
Description
Recombinant SARS-CoV-2 Nucleocapsid Protein full length, His-tagged (PODTC9) NC 045512.2; free of nucleic acid | 13 100 102\13100103 | BioTeZ
Product Features:
Product Group: Protein
Minimum Shelf life Time in months: 6 months
Package size (cm) in Europe/ ouside Europe: 27 x 17 x 19 \33 x 25 x 23
Application: The recombinant Nucleocapsid can serve as standard in immunochemical assays, in Western Blot or other methods.
Concentration: could vary
Buffe: The Nucleocapsid protein is solubilized in 25 mM Na-Phosphat, pH 6.8, 250 mM NaCl, 2 mM Mercaptoethanol
Molecular Weight: 46.5 kDa
Host: N/A
Clonality: N/A
Conjugate: His-tagged
Immunogen Info: N/A
Product description: SARS-CoV-2 Nucleocapsid protein is the main structural protein of SARSassociated coronavirus (CoV) that binds the viral RNA genome. It is a recombinant protein, expressed in E.coli cells. The protein consists of 419 amino acids and a C-terminal His6-tag.
Reactivity: N/A
Cross Reactivity: N/A
No Cross Reactivity: N/A
Sequence: MSDNGPQNQRNAPRITFGGPSDSTGSNQNGERSGARSKQRRPQGLPNNTASWFTALTQHGKEDLKFPRGQGVPINTNSS PDDQIGYYRRATRRIRGGDGKMKDLSPRWYFYYLGTGPEAGLPYGANKDGIIWVATEGALNTPKDHIGTRNPANNAAIVLQ LPQGTTLPKGFYAEGSRGGSQASSRSSSRSRNSSRNSTPGSSRGTSPARMAGNGGDAALALLLLDRLNQLESKMSGKGQQQ QGQTVTKKSAAEASKKPRQKRTATKAYNVTQAFGRRGPEQTQGNFGDQELIRQGTDYKHWPQIAQFAPSASAFFGMSRIG MEVTPSGTWLTYTGAIKLDDKDPNFKDQVILLNKHIDAYKTFPPTEPKKDKKKKADETQALPQRQKKQQTVTLLPAADLDDF SKQLQQSMSSADSTQAHHHHHH
Addtional Names: SARS-CoV-2 Nucleocapsid Protein (PODTC9)
Specificity: N/A
Format: liquid
Purity: > 90%
Purification: N/A
Storage: Store at -70°C
Shipping Temp Min: dry ice
Isotype: N/A
Clone: N/A
Source: Recombinant, E.coli
Gene ID: N/A
Uniprot/NCBI/GeneID: NC 045512.2
NCBI Official Symbol: N-SARS2
NCBI Official Full Name: SARS-CoV-2 Nucleocapsid Protein (PODTC9)
NCBI Organism: Streptococcus sp