Recombinant SARS-CoV-2 Nucleocapsid Protein full length, His-tagged (PODTC9) NC_045512.2; free of nucleic acid

Recombinant SARS-CoV-2 Nucleocapsid Protein full length, His-tagged (PODTC9) NC 045512.2; free of nucleic acid | 13 100 102\13100103 | BioTeZ

Product Features:

Product Group: Protein

Minimum Shelf life Time in months: 6 months

Package size (cm) in Europe/ ouside Europe: 27 x 17 x 19 \33 x 25 x 23

Application: The recombinant Nucleocapsid can serve as standard in immunochemical assays, in Western Blot or other methods.

Concentration: could vary

Buffe: The Nucleocapsid protein is solubilized in 25 mM Na-Phosphat, pH 6.8, 250 mM NaCl, 2 mM Mercaptoethanol

Molecular Weight: 46.5 kDa

Host: N/A

Clonality: N/A

Conjugate: His-tagged

Immunogen Info: N/A

Product description: SARS-CoV-2 Nucleocapsid protein is the main structural protein of SARSassociated coronavirus (CoV) that binds the viral RNA genome. It is a recombinant protein, expressed in E.coli cells. The protein consists of 419 amino acids and a C-terminal His6-tag.

Reactivity: N/A

Cross Reactivity: N/A

No Cross Reactivity: N/A

Sequence: MSDNGPQNQRNAPRITFGGPSDSTGSNQNGERSGARSKQRRPQGLPNNTASWFTALTQHGKEDLKFPRGQGVPINTNSS PDDQIGYYRRATRRIRGGDGKMKDLSPRWYFYYLGTGPEAGLPYGANKDGIIWVATEGALNTPKDHIGTRNPANNAAIVLQ LPQGTTLPKGFYAEGSRGGSQASSRSSSRSRNSSRNSTPGSSRGTSPARMAGNGGDAALALLLLDRLNQLESKMSGKGQQQ QGQTVTKKSAAEASKKPRQKRTATKAYNVTQAFGRRGPEQTQGNFGDQELIRQGTDYKHWPQIAQFAPSASAFFGMSRIG MEVTPSGTWLTYTGAIKLDDKDPNFKDQVILLNKHIDAYKTFPPTEPKKDKKKKADETQALPQRQKKQQTVTLLPAADLDDF SKQLQQSMSSADSTQAHHHHHH

Addtional Names: SARS-CoV-2 Nucleocapsid Protein (PODTC9)

Specificity: N/A

Format: liquid

Purity: > 90%

Purification: N/A

Storage: Store at -70°C

Shipping Temp Min: dry ice

Isotype: N/A

Clone: N/A

Source: Recombinant, E.coli

Gene ID: N/A

Uniprot/NCBI/GeneID: NC 045512.2

NCBI Official Symbol: N-SARS2

NCBI Official Full Name: SARS-CoV-2 Nucleocapsid Protein (PODTC9)

NCBI Organism: Streptococcus sp