Description 0 Reviews Description SLC7A10 Antibody Expression system: Yeast Purity: > 90% SDS-PAGE Suitable for: SDS-PAGE Product name Recombinant Mouse SLC7A10 protein (Tagged) Purity > 90 % SDS-PAGE. Expression system Yeast Accession P63115 Protein length Protein fragment Animal free No Nature Recombinant Species Mouse Sequence WRSKPKCVHRFTESMTRWGQELCFVVYPQGSLEEEENGPMGQPSPLPITD KPLKTQ Amino acids 475 to 530 Additional sequence information N-terminal 6xHis-sumostar-tagged View AllClose 0 Reviews View AllClose
Add to Cart Quick view ANO5 Antibody | Gentaur MSRP: Now: Select Currency //340.00 Was: ANO5 13-ORB39268-GEN
Add to Cart Quick view C15orf41 Antibody | Gentaur MSRP: Now: Select Currency //340.00 Was: C15or 399-CSB-PA897474LA-GEN
Add to Cart Quick view HAS2 Antibody | Gentaur MSRP: Now: Select Currency //340.00 Was: HAS2 13-ORB157430-100UG-GEN
Add to Cart Quick view CBLB Antibody | Gentaur MSRP: Now: Select Currency //340.00 Was: CBLB 639-abx034055-GEN
Add to Cart Quick view CRTC3 Antibody | Gentaur MSRP: Now: Select Currency //340.00 Was: CRTC3 796-DF7891-GEN